Bacterial taxon 909946
Locus STM474_1964
Protein WP_000741710.1
non-heme ferritin-like protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 167 aa, Gene ftnB, UniProt E8XA78
>WP_000741710.1|Salmonella enterica Serovar Typhimurium ST4 74|non-heme ferritin-like protein
MAAVGMVQKLNTPMNLEFYASSLYLHLSEWCSEHSLTGTATFLRTQAQGNVTQMMRMFNFMKNAGATPIVKAIDVPGEELCSLEELFQKTLEDYQQRASTLSRLADEAKALNDASTLDFLHTLEKEQQQDGVLLQTILEEVRSAKRAGLCLAQTDQHLLNVVTYQHH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,985,020 | -1.87 | 0.087 | ●○○○○ -0.79 | -0.792411528194539 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,985,020 | 1.02 | 0.72 | ○○○○○ 0.71 | 0.709342867093438 | 23637626 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)