Bacterial taxon 909946
Locus STM474_4514
Protein WP_000842434.1
non-specific acid phosphatase
Salmonella enterica Serovar Typhimurium ST4 74
Length 250 aa, Gene phoN, UniProt E8X9W9
>WP_000842434.1|Salmonella enterica Serovar Typhimurium ST4 74|non-specific acid phosphatase
MKSRYLVFFLPLIVAKYTSAETVQPFHSPEESVNSQFYLPPPPGNDDPAYRYDKEAYFKGYAIKGSPRWKQAAEDADVSVENIARIFSPVVGAKINPKDTPETWNMLKNLLTMGGYYATASAKKYYMRTRPFVLFNHSTCRPEDENTLRKNGSYPSGHTAYGTLLALVLSEARPERAQELARRGWEFGQSRVICGAHWQSDVDAGRYVGAVEFARLQTIPAFQKSLAKVREELNDKNNLLSKEDHPKLNY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,584,255 | -1.51 | 0.0031 | ●○○○○ -0.61 | -0.608480742634499 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,584,255 | -2.2 | 0.053 | ●○○○○ -0.96 | -0.963821832617473 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,584,255 | -0.99 | 0.4 | ●○○○○ -0.34 | -0.339279833507671 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)