Bacterial taxon 909946
Locus STM474_1539
Protein WP_000513122.1
nuclear transport factor 2 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 180 aa, Gene n/a, UniProt E8XIX5
>WP_000513122.1|Salmonella enterica Serovar Typhimurium ST4 74|nuclear transport factor 2 family protein
MGITIMQKTSLLFSAAAITLTLMASSASAATPTAAQNEATSTVKQEITEGINRYLYSIDKADPTLGKQLFYVSPETSFIHPRGHERGWSQIAENFYGTTMGKTFSKRTLKLDAPPAIHVYGNAAVAEFDWHFTAVRRDNGQTQHTTGRESQVWAKIPNTGWRIVHVHYSGPAKTGVGEGY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,562,493 | -6.92 | 3.1e-24 | ●●●●○ -3.42 | -3.41626928195957 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,562,493 | -5.14 | 8.2e-6 | ●●●○○ -2.49 | -2.49215101789051 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,562,493 | -4.27 | 3.9e-6 | ●●●○○ -2.04 | -2.04254222133592 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)