Bacterial taxon 909946
Locus STM474_2319
Protein WP_000050806.1
nucleoid-associated protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 335 aa, Gene yejK, UniProt E8XDR6
>WP_000050806.1|Salmonella enterica Serovar Typhimurium ST4 74|nucleoid-associated protein
MSLDINQIALHQLIKRDEQNLELVLRDSLLEPTTTVVEMVAELHRVYSAKNKAYGLFNEESELAQALRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGIVLFCHYRYLAVEYLLVTVLNNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPQSTRYLTFLKGRVGRKVADFFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEIELESLSKELSGVSEVSFSEFTAEKGYELEESFPADRSTLRQLTKYAGSGGGLTINFDAMLLGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,325,781 | -0.79 | 0.22 | ●○○○○ -0.23 | -0.231592556220041 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,325,781 | -0.57 | 0.68 | ●○○○○ -0.12 | -0.120528913238777 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,325,781 | 0.99 | 0.73 | ○○○○○ 0.69 | 0.689115444925514 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)