Bacterial taxon 909946
Locus STM474_1142
Protein WP_000203944.1
O-acetyl-ADP-ribose deacetylase
Salmonella enterica Serovar Typhimurium ST4 74
Length 179 aa, Gene ymdB, UniProt E8XER5
>WP_000203944.1|Salmonella enterica Serovar Typhimurium ST4 74|O-acetyl-ADP-ribose deacetylase
MTSRLQVIQGDITQLSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQQGECQTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANHFRSIAFPAISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLTQQGDDPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,189,304 | -0.92 | 0.42 | ●○○○○ -0.3 | -0.302104352068458 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,189,304 | 1.24 | 0.7 | ○○○○○ 0.82 | 0.819144378478958 | 23637626 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)