Bacterial taxon 909946
Locus STM474_1763
Protein WP_000911097.1
oligopeptide ABC transporter permease OppB
Salmonella enterica Serovar Typhimurium ST4 74
Length 306 aa, Gene oppB, UniProt E8XKW3
>WP_000911097.1|Salmonella enterica Serovar Typhimurium ST4 74|oligopeptide ABC transporter permease OppB
MLKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGERALPPEVLANIEAKYHLNDPIMTQYFSYLKQLAHGDFGPSFKYKDYTVNDLVAASFPVSAKLGAAAFLLAVIIGVSAGVIAALKQNTRWDYTVMGFAMTGVVIPSFVVAPLLVMVFAITLQWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIIFRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVIDPKIRY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,796,167 | -2.73 | 5.4e-8 | ●●○○○ -1.24 | -1.24246698630324 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,796,167 | -1.47 | 0.31 | ●○○○○ -0.58 | -0.584761809196801 | 23637626 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)