Bacterial taxon 909946
Locus STM474_2494
Protein WP_000716007.1
omptin family outer membrane protease PgtE
Salmonella enterica Serovar Typhimurium ST4 74
Length 312 aa, Gene pgtE, UniProt E8XF49
>WP_000716007.1|Salmonella enterica Serovar Typhimurium ST4 74|omptin family outer membrane protease PgtE
MKKHAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKLSQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHDWMSSEQPGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNAHDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTAYFGGDAAGIANNNYTVTAGLQYRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,504,608 | -0.99 | 0.19 | ●○○○○ -0.34 | -0.336317745421381 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,504,599 | -0.4 | 0.89 | ●○○○○ -0.03 | -0.0319986969867593 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,504,599 | -0.27 | 0.75 | ○○○○○ 0.04 | 0.0389446634174809 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,504,562 | -0.09 | 0.91 | ○○○○○ 0.13 | 0.127775369189384 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,504,623 | -0.03 | 0.97 | ○○○○○ 0.16 | 0.161057429750908 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,504,599 | -0.02 | 0.87 | ○○○○○ 0.17 | 0.165871759734889 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,504,623 | 0.6 | 0.89 | ○○○○○ 0.49 | 0.487979055305269 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,504,608 | 0.64 | 0.73 | ○○○○○ 0.51 | 0.510331670669669 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,504,623 | 0.86 | 0.59 | ○○○○○ 0.62 | 0.623875958040942 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,504,562 | 1.29 | 0.62 | ○○○○○ 0.85 | 0.84623645889764 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,504,562 | 1.74 | 0.33 | ○○○○○ 1.08 | 1.08151550185795 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,504,608 | 2.84 | 0.89 | ○○○○○ 1.65 | 1.65105180968595 | 23637626 |
Retrieved 12 of 12 entries in 1.1 ms
(Link to these results)