Bacterial taxon 909946
Locus STM474_1575
Protein WP_000152297.1
OsmC family peroxiredoxin
Salmonella enterica Serovar Typhimurium ST4 74
Length 143 aa, Gene osmC, UniProt E8XJ10
>WP_000152297.1|Salmonella enterica Serovar Typhimurium ST4 74|OsmC family peroxiredoxin
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAGCPVSQVLNAEITLDYQLNA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,601,332 | -6.2 | 9.0e-9 | ●●●●○ -3.04 | -3.04363266961084 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,601,332 | -1.4 | 0.73 | ●○○○○ -0.55 | -0.547348307124975 | 23637626 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)