Bacterial taxon 909946
Locus STM474_1720
Protein WP_000481166.1
osmotically-inducible lipoprotein OsmB
Salmonella enterica Serovar Typhimurium ST4 74
Length 72 aa, Gene osmB, UniProt E8XKS0
>WP_000481166.1|Salmonella enterica Serovar Typhimurium ST4 74|osmotically-inducible lipoprotein OsmB
MFMTSKKMAAAVLAITVAMSLSACSNWSKRDRNTAIGAGAGALGGAVLTDGSTLGTLGGAAVGGVIGHQVGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,756,838 | -2.65 | 2.3e-7 | ●●○○○ -1.2 | -1.19653215281428 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,756,838 | -1.69 | 0.2 | ●○○○○ -0.7 | -0.701880496699322 | 23637626 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)