Bacterial taxon 909946
Locus STM474_2273
Protein WP_000920081.1
outer membrane permeability protein SanA
Salmonella enterica Serovar Typhimurium ST4 74
Length 239 aa, Gene sanA, UniProt E8XDM1
>WP_000920081.1|Salmonella enterica Serovar Typhimurium ST4 74|outer membrane permeability protein SanA
MLKRVFYSLLVLVGLLLLTVLGLDRWMSWKTAPYIYDELQDLPYRQVGVVLGTAKYYRKGVINQYYRYRIQGALNAYNSGKVNYLLLSGDNALQSYNEPMTMRKDLIAAGVDPADIVLDYAGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVPSPKNMLTVRLREFGARFSALADLYIFKREPRFLGPLVPIPTQHQVPNDAQGYPAVTPEQLLELEKKKGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,278,203 | -3.45 | 0.0014 | ●●○○○ -1.62 | -1.61669147767776 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,278,203 | -1.59 | 0.11 | ●○○○○ -0.65 | -0.648300103621788 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,278,203 | -0.39 | 0.5 | ●○○○○ -0.03 | -0.0277814143107871 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)