Bacterial taxon 909946
Locus STM474_0858
Protein WP_000716763.1
outer membrane protein OmpX
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene ompX, UniProt E8XBU5
>WP_000716763.1|Salmonella enterica Serovar Typhimurium ST4 74|outer membrane protein OmpX
MKKIACLSALAAVLAFSAGTAVAATSTVTGGYAQSDAQGVANKMSGFNLKYRYEQDDNPLGVIGSFTYTEKDRTNGAGDYNKGQYYGITAGPAYRLNDWASIYGVVGVGYGKFQTTDYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 899,166 | 0.56 | 0.89 | ○○○○○ 0.47 | 0.467835085455293 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 899,166 | 1.04 | 0.19 | ○○○○○ 0.72 | 0.715636030917105 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 899,166 | 1.49 | 0.55 | ○○○○○ 0.95 | 0.949866729612077 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 899,051 | 1.93 | 0.73 | ○○○○○ 1.18 | 1.17825653775239 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 899,051 | 2.13 | 0.17 | ○○○○○ 1.28 | 1.28408274115685 | 23637626 |
Retrieved 5 of 5 entries in 0.5 ms
(Link to these results)