Bacterial taxon 909946
Locus STM474_3639
Protein WP_000920478.1
peptidylprolyl isomerase A
Salmonella enterica Serovar Typhimurium ST4 74
Length 190 aa, Gene ppia, UniProt E8XEH5
>WP_000920478.1|Salmonella enterica Serovar Typhimurium ST4 74|peptidylprolyl isomerase A
MLKSTLAAVAAVFALSALSPAALAAKGDPHVLLTTSAGNIELELNSQKAPVSVKNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFNEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPTKPVVILSAKVLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,642,907 | -0.75 | 0.33 | ●○○○○ -0.21 | -0.211419019186344 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,642,907 | 0.73 | 0.74 | ○○○○○ 0.55 | 0.55387179856546 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,642,907 | 1.31 | 0.61 | ○○○○○ 0.86 | 0.858796451056771 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)