Bacterial taxon 909946
Locus STM474_4088
Protein WP_001096806.1
peptidylprolyl isomerase C
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene ppiC, UniProt E8XIM1
>WP_001096806.1|Salmonella enterica Serovar Typhimurium ST4 74|peptidylprolyl isomerase C
MAKMAAALHILVKEEKLALDLLEQIKNGGDFEKLAKKHSICPSGKKGGHLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,140,516 | 0.32 | 0.97 | ○○○○○ 0.34 | 0.3433394762349 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,140,516 | 0.82 | 0.59 | ○○○○○ 0.6 | 0.604159243473222 | 23637626 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)