Bacterial taxon 909946
Locus STM474_0005
Protein WP_000906175.1
peroxide stress protein YaaA
Salmonella enterica Serovar Typhimurium ST4 74
Length 257 aa, Gene yaaa, UniProt E8XG25
>WP_000906175.1|Salmonella enterica Serovar Typhimurium ST4 74|peroxide stress protein YaaA
MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQGDRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIENRLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 5,567 | -1.45 | 0.0088 | ●○○○○ -0.58 | -0.578319445214755 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 5,567 | -0.8 | 0.74 | ●○○○○ -0.24 | -0.236550806489617 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 5,765 | 0.15 | 1 | ○○○○○ 0.26 | 0.255543129063546 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 5,567 | 0.17 | 0.91 | ○○○○○ 0.27 | 0.265420434324025 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 5,765 | 0.38 | 0.77 | ○○○○○ 0.37 | 0.37466219662353 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 5,765 | 0.88 | 0.14 | ○○○○○ 0.63 | 0.633308938663553 | 23637626 |
Retrieved 6 of 6 entries in 0.7 ms
(Link to these results)