Bacterial taxon 909946
Locus STM474_3522
Protein WP_000853277.1
peroxide/acid stress response protein YhcN
Salmonella enterica Serovar Typhimurium ST4 74
Length 88 aa, Gene n/a, UniProt E8XD65
>WP_000853277.1|Salmonella enterica Serovar Typhimurium ST4 74|peroxide/acid stress response protein YhcN
MKTKYIIASLGLATLLSFGANAAVHQVNAEQAQNLQPMGTISVSQIGSTPMDMRQEIVAKAEKAGANSYRIIELKEGDNWHATAELYK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,550,732 | 0.45 | 0.92 | ○○○○○ 0.41 | 0.41192173174714 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,550,732 | 1.31 | 0.096 | ○○○○○ 0.86 | 0.856128693417759 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)