Bacterial taxon 909946
Locus STM474_1030
Protein WP_000478859.1
phage minor tail protein G
Salmonella enterica Serovar Typhimurium ST4 74
Length 132 aa, Gene n/a, UniProt E8XDJ3
>WP_000478859.1|Salmonella enterica Serovar Typhimurium ST4 74|phage minor tail protein G
MFLKKETFTRGDASVALFELSGLQRIEYLEFIQKRTAKYDTDMDGTTEADKRVAYMQMALEINAWLVSRSLLNGDSSQDADTLYQSVQAKWSYEALDAGAESVLMLSGLSADKKDNASDSGNESEDMTPEKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,081,972 | -1.26 | 0.015 | ●○○○○ -0.48 | -0.476406033127134 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,081,972 | -0.09 | 0.95 | ○○○○○ 0.13 | 0.129931918089485 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,081,972 | 1.35 | 0.54 | ○○○○○ 0.88 | 0.875915712293285 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)