Bacterial taxon 909946
Locus STM474_2043
Protein WP_000588852.1
phage tail assembly protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 108 aa, Gene n/a, UniProt E8XB31
>WP_000588852.1|Salmonella enterica Serovar Typhimurium ST4 74|phage tail assembly protein
MIKELVLKKPIMAHNEKLHVLELREPSYDEIEAIGFPFTVSGDGGVRLDSSVALKYIPVLAGIPRSSAAQLAKLDIFKACMLILNFFTRSETEEDSESGSTTPHTSGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,051,016 | -0.13 | 0.88 | ○○○○○ 0.11 | 0.111483833302631 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,051,016 | 0.83 | 0.8 | ○○○○○ 0.61 | 0.606665397121711 | 23637626 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)