Bacterial taxon 909946
Locus STM474_2822
Protein WP_001280960.1
phage tail assembly protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 100 aa, Gene n/a, UniProt E8XIH6
>WP_001280960.1|Salmonella enterica Serovar Typhimurium ST4 74|phage tail assembly protein
MSDKLTEKTVELDTPIMRGKAEITEIVLRKPQSGALRGTRLQAIMDMDVGAMMTVIPRISTPTLTAQEMAELDPADLTALSVEVVTFLLKKSVLAGLPTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,860,685 | 0.59 | 0.89 | ○○○○○ 0.48 | 0.481989174914694 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,860,685 | 1.2 | 0.11 | ○○○○○ 0.8 | 0.798625025097774 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,860,685 | 1.73 | 0.37 | ○○○○○ 1.08 | 1.07725217570006 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)