Bacterial taxon 909946
Locus STM474_2829
Protein WP_001086808.1
phage tail protein I
Salmonella enterica Serovar Typhimurium ST4 74
Length 201 aa, Gene n/a, UniProt E8XJ55
>WP_001086808.1|Salmonella enterica Serovar Typhimurium ST4 74|phage tail protein I
MNSLLPPGSSPLERRLAQTCSGISDLQVSLRDLWNPATCPIRFLPYLAWALSVDRWDESWTENVKRRVVQDAFYIHQHKGTISAVRRVVEPFGFLIRIIEWWQTGETPGTFRLDIGVQDHGITEDTYLELERLISDAKPCSRHMTGMSINMQTSGPYWVGAASYLGEEITVYPYINETIVSGGTAYEGGAVHVIDTMRVNP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,866,160 | 2.38 | 0.0041 | ○○○○○ 1.41 | 1.41414309792483 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,866,160 | 0.5 | 0.71 | ○○○○○ 0.44 | 0.439078651205489 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,866,160 | 1.03 | 0.71 | ○○○○○ 0.71 | 0.710687666841899 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)