Bacterial taxon 909946
Locus STM474_4485
Protein WP_000056482.1
phnA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 111 aa, Gene phnA, UniProt E8X9U0
>WP_000056482.1|Salmonella enterica Serovar Typhimurium ST4 74|phnA family protein
MSLPHCPQCNSEYTYEDNGMFICPECAHEWNDAEPAQESDELIVKDANGNLLADGDSVTIVKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLKSEFVKKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,551,788 | 0.2 | 0.99 | ○○○○○ 0.28 | 0.279291970355424 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,551,788 | 0.63 | 0.76 | ○○○○○ 0.51 | 0.506036393154167 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,551,788 | 0.68 | 0.43 | ○○○○○ 0.53 | 0.532211734563779 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)