Bacterial taxon 909946
Locus STM474_3485
Protein WP_000602196.1
PhoP regulatory network protein YrbL
Salmonella enterica Serovar Typhimurium ST4 74
Length 210 aa, Gene yrbL, UniProt E8XD28
>WP_000602196.1|Salmonella enterica Serovar Typhimurium ST4 74|PhoP regulatory network protein YrbL
MILLSKQTPLGAGRHRKCYTHPDNARRCIKVIYNRDHGGDKEIRRELSYYAHLSRYLTDWSAIPRYYGTVETDCGTGYVYDMITDFNGAPSITLTEFAAQCRYEEDVAVLRRLLKKLKRYLLDNHIVTMSLKPQNILCQRISESEVVPVVCDNLGESTFIPLATWSTWCCERKLERVWQRFIAQPALAVALERDAQPKDKKRLALTSHEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,509,747 | -0.06 | 0.94 | ○○○○○ 0.15 | 0.146059250296214 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,509,747 | 0.14 | 0.94 | ○○○○○ 0.25 | 0.24953773414564 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,509,747 | 0.54 | 0.9 | ○○○○○ 0.46 | 0.458247644016165 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)