Bacterial taxon 909946
Locus STM474_4035
Protein WP_000741630.1
phosphate ABC transporter permease PstC
Salmonella enterica Serovar Typhimurium ST4 74
Length 319 aa, Gene pstC, UniProt E8XHU4
>WP_000741630.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphate ABC transporter permease PstC
MAATKPAFNPPGKKGDMIFSALVKLAALIVLLMLGGIIVSLIISSWPSIQKFGFSFLWTKEWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLAAIPSIVYGMWGLFIFAPLFATYFQEPVGNILSNIPFVGALFSGPAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALGETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFIVLAASKFMIMRLAKNEGAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,083,902 | -5.01 | 4.4e-6 | ●●●○○ -2.42 | -2.42418452215367 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,083,902 | -3.65 | 4.9e-5 | ●●○○○ -1.72 | -1.71927103657104 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,083,902 | -0.34 | 0.68 | ○○○○○ 0 | 0.00248852011368338 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)