Bacterial taxon 909946
Locus STM474_0400
Protein WP_000705165.1
phosphate starvation-inducible protein PsiF
Salmonella enterica Serovar Typhimurium ST4 74
Length 106 aa, Gene n/a, UniProt E8XJT4
>WP_000705165.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphate starvation-inducible protein PsiF
MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQALKGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACLKKAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 437,495 | -0.77 | 0.52 | ●○○○○ -0.22 | -0.220433277906218 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 437,495 | -0.58 | 0.82 | ●○○○○ -0.13 | -0.126612111888395 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 437,495 | 1.11 | 0.15 | ○○○○○ 0.75 | 0.753399071265034 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)