Bacterial taxon 909946
Locus STM474_4420
Protein WP_000982749.1
phosphate-starvation-inducible protein PsiE
Salmonella enterica Serovar Typhimurium ST4 74
Length 136 aa, Gene yjbA, UniProt E8X8Y8
>WP_000982749.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphate-starvation-inducible protein PsiE
MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFAPEQASKYELVEGLVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILLLVITLWLCNSNRLRRE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,467,539 | 0.06 | 1 | ○○○○○ 0.21 | 0.20905074474779 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,467,539 | 0.88 | 0.54 | ○○○○○ 0.64 | 0.635576200269325 | 23637626 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)