Bacterial taxon 909946
Locus STM474_0625
Protein WP_000118144.1
phosphoadenosine phosphosulfate reductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 411 aa, Gene ybdN, UniProt E8X976
>WP_000118144.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphoadenosine phosphosulfate reductase
MSVYKVPLEQNVLEAAQERIMWTLETLPRVCVSFSGGKDSGLMLHLTATLARKMNKKIHVLFIDWEAQFSCTITYIESLREYYADVIERFYWVALPLTTQNSLSQYQPEWQCWQPGTDWVRQPPEDAITDPAFFSFYQHGMTFEQFVRDFADWFSEKRPAAMLVGIRSDESYNRFAAIANSHKLRFADDKPWTTLAPKGHTWYIYPIYDWKTADIWTWFAKTGKPCNPLYNLMYQAGVPPRYMRICEPFGPEQRQGLWLYHVIEPERWAAMCARVSGALSGGIYAGQDSHFYGHRKILKPDHLNWEEYALLLLHSMPEVTAEHYRNKIAVYLQWYKKKGMHTIPQTQHGDIGSRDIPSWRRICKVLLNNDYWCRALSFSPTKPKNYQRYNERMKAKRQEWGILCNTDSQPK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 667,028 | -2.03 | 0.00054 | ●○○○○ -0.88 | -0.879480183533852 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 667,028 | -0.93 | 0.66 | ●○○○○ -0.31 | -0.307605340231688 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 667,028 | -0.74 | 0.55 | ●○○○○ -0.21 | -0.207598515808143 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)