Bacterial taxon 909946
Locus STM474_3088
Protein WP_000080404.1
phosphoadenosine phosphosulfate reductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 244 aa, Gene cysH, UniProt E8X8M7
>WP_000080404.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphoadenosine phosphosulfate reductase
MSQLDLNALNELPKVDRVMALAETNAQLEKLSAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRAGESPAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELKAQTWFAGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,110,869 | -2.1 | 0.01 | ●○○○○ -0.91 | -0.912283873703622 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,110,869 | -0.36 | 0.81 | ●○○○○ -0.01 | -0.0122241390679985 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,110,869 | 0.44 | 0.97 | ○○○○○ 0.4 | 0.40367464160656 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)