Bacterial taxon 909946
Locus STM474_4791
Protein WP_000942363.1
phosphoglycerate mutase GpmB
Salmonella enterica Serovar Typhimurium ST4 74
Length 215 aa, Gene gpmB, UniProt E8XDB9
>WP_000942363.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphoglycerate mutase GpmB
MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGITHIISSDLGRTKRTAEIIAQACGCDITFDSRLRELDMGVLEKRQIDSLTEEEEGWRRQLVNGTQDGRIPGGESMQELSDRVHAALASCLELPQGSRPLLVSHGIALGCLVSTILGLPAWAERRLRLRNCSISRIDYQESQWLASGWVVETAGDVSHLDAPALDELQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,863,013 | 1.08 | 0.039 | ○○○○○ 0.74 | 0.737391525230806 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,863,013 | 0.42 | 0.99 | ○○○○○ 0.4 | 0.395670276570663 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,863,013 | 1.32 | 0.35 | ○○○○○ 0.86 | 0.861420785156639 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)