Bacterial taxon 909946
Locus STM474_2486
Protein WP_001195800.1
phosphohistidine phosphatase SixA
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene sixA, UniProt E8XF42
>WP_001195800.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphohistidine phosphatase SixA
MQVFIMRHGDAALDAASDSVRPLTPCGCDESRLMANWLKGQKVDIERVLVSPFLRAEQTLDVVGDCMNLPAQVDVLPELTPCGDVGLVSAYLQALANEEIGSVLVISHLPLVGYLVSELCPGETPPMFTTSAIANVTLDESGKGTFNWQMSPCNLKMAKAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,495,434 | -3.11 | 0.0044 | ●●○○○ -1.44 | -1.43611802596541 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,495,434 | -3.1 | 0.012 | ●●○○○ -1.43 | -1.43498294367787 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,495,434 | 0.84 | 0.12 | ○○○○○ 0.61 | 0.613366783343057 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)