Bacterial taxon 909946
Locus STM474_0314
Protein WP_001535430.1
pili assembly chaperone PapD
Salmonella enterica Serovar Typhimurium ST4 74
Length 245 aa, Gene safB, UniProt E8XIW7
>WP_001535430.1|Salmonella enterica Serovar Typhimurium ST4 74|pili assembly chaperone PapD
MKIVNFAVMAVALFATNSMVSVYAVNQQLNSATKLFSVKLGATRVIYHAGTAGATLSVSNPQNYPILVQSSVKAADKSSPAPFLVMPPLFRLEANQQSQLRIVRTGGDMPTDRETLQWVCIKAVPPENEPSDTQAKGATLDLNLSINACDKLIFRPDAVKGTPEDVAGNLRWVETGNKLKVENPTPFYMNLASVTVGGKPITGLEYVPPFADKTLNMPGSAHGDIEWRVITDFGGESHPFHYVLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 342,990 | -3.45 | 0.0002 | ●●○○○ -1.62 | -1.61604768477433 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 342,990 | -3.19 | 0.0033 | ●●○○○ -1.48 | -1.47720583964724 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 342,896 | -0.41 | 0.92 | ●○○○○ -0.03 | -0.0349774561142683 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 342,990 | -0.36 | 0.66 | ●○○○○ -0.01 | -0.0101769064362804 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 342,896 | -0.12 | 0.88 | ○○○○○ 0.11 | 0.114907855469711 | 23637626 |
Retrieved 5 of 5 entries in 1.1 ms
(Link to these results)