Bacterial taxon 909946
Locus STM474_0316
Protein WP_000266939.1
pilin structural protein SafD
Salmonella enterica Serovar Typhimurium ST4 74
Length 156 aa, Gene safD, UniProt E8XIW9
>WP_000266939.1|Salmonella enterica Serovar Typhimurium ST4 74|pilin structural protein SafD
MWMKIQRVKTVIYSVSLLVAASSLVPIANAAEKLQTTLRVGTYFRAGHVPDGMVLAQGWVTYHGSHSGFRVWSDEQKAGNTPTVLLLSGQQDPRHHIQVRLEGEGWQPDTVSGRGAILRTAADNASFSVVVDGNQEVPADTWTLDFKACALAQEDT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 345,880 | 0.23 | 0.76 | ○○○○○ 0.3 | 0.297387627399059 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 345,880 | 0.35 | 0.8 | ○○○○○ 0.36 | 0.356288475627667 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 345,880 | 0.52 | 0.91 | ○○○○○ 0.45 | 0.445769175959417 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)