Bacterial taxon 909946
Locus STM474_0726
Protein WP_000579804.1
potassium-transporting ATPase subunit KdpC
Salmonella enterica Serovar Typhimurium ST4 74
Length 194 aa, Gene kdpC, UniProt E8XAT8
>WP_000579804.1|Salmonella enterica Serovar Typhimurium ST4 74|potassium-transporting ATPase subunit KdpC
MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQANGSLIHKDNVIRGSALIGQSFTAAGYFHGRPSATADTPYNPLASGGSNLAASNPELDAQIQARVAALRAANPQASSAVPVELATASASGLDNNLTPGAAAWQIPRVAAARQLPVEQVAQLVAEYTHRPLARFLGQPVVNIVELNLALDALQGHRAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 769,516 | 0.03 | 0.95 | ○○○○○ 0.19 | 0.194063727963054 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 769,413 | 0.25 | 0.97 | ○○○○○ 0.31 | 0.308803528718165 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 769,516 | 0.88 | 0.45 | ○○○○○ 0.63 | 0.632495146527795 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 769,413 | 0.89 | 0.094 | ○○○○○ 0.64 | 0.636712476461407 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 769,516 | 1.02 | 0.89 | ○○○○○ 0.71 | 0.708271851105263 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 769,413 | 1.15 | 0.47 | ○○○○○ 0.77 | 0.774553857621248 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)