Bacterial taxon 909946
Locus STM474_3145
Protein WP_000029150.1
prepilin peptidase-dependent protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 187 aa, Gene ppdb, UniProt E8X8T2
>WP_000029150.1|Salmonella enterica Serovar Typhimurium ST4 74|prepilin peptidase-dependent protein
MSITTRGFSLLEVVLAMAIGSILLLGSARFLPALQREIWHNTRQLSLEDEIWQRTYTVAKHLQRAGYCHGHCIGEGLHLAEQGQCVIVQWDGNNNGVWDTIPAKEADQTGFRMKDNVLETLRGATSCQGKGWEKMTDPNTVLITAFTVERRDITGFSPVLMLHLRGASKAEPQTVIDAQYSVTGFNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,178,500 | 0.99 | 0.73 | ○○○○○ 0.69 | 0.691418179881345 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,178,415 | 1.02 | 0.72 | ○○○○○ 0.71 | 0.707127823621634 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,178,500 | 1.03 | 0.72 | ○○○○○ 0.71 | 0.710064060740357 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,178,415 | 1.72 | 0.18 | ○○○○○ 1.07 | 1.06822259407999 | 23637626 |
Retrieved 4 of 4 entries in 0.5 ms
(Link to these results)