Bacterial taxon 909946
Locus STM474_3146
Protein WP_000744675.1
prepilin peptidase-dependent protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 156 aa, Gene ppdA, UniProt E8X8T3
>WP_000744675.1|Salmonella enterica Serovar Typhimurium ST4 74|prepilin peptidase-dependent protein
MKKQQGYTLIETVVAMSLIIILSATGLYGWQRWQQQQRLWQTACQVRDYLLQLRGDAHWHNRDHILRVVSEGGSWCFVSSVATQTSCTPSSPFVFTPDWRDVVLADITPSLAFFGLRNTAWAGHIVLKNAAGEWRLVVSSWGRIRLCERNEAATCQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,178,858 | 1.82 | 0.012 | ○○○○○ 1.12 | 1.12271180973296 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,178,965 | -0.09 | 0.96 | ○○○○○ 0.13 | 0.132045056952625 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,179,226 | 0.2 | 0.98 | ○○○○○ 0.28 | 0.279104106696646 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,178,965 | 0.41 | 0.94 | ○○○○○ 0.39 | 0.387595959841656 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,178,965 | 0.7 | 0.29 | ○○○○○ 0.54 | 0.539193619284773 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,179,226 | 0.97 | 0.41 | ○○○○○ 0.68 | 0.678332154625237 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,179,010 | 1.32 | 0.57 | ○○○○○ 0.86 | 0.861176931061751 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,179,010 | 1.36 | 0.11 | ○○○○○ 0.88 | 0.882413199455856 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,178,858 | 1.51 | 0.22 | ○○○○○ 0.96 | 0.961726022360495 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,179,010 | 1.55 | 0.18 | ○○○○○ 0.98 | 0.980520963682225 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,178,858 | 1.74 | 0.33 | ○○○○○ 1.08 | 1.07885941322075 | 23637626 |
Retrieved 11 of 11 entries in 1.4 ms
(Link to these results)