Bacterial taxon 909946
Locus STM474_0501
Protein WP_000926658.1
primosomal replication protein N''
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene priC, UniProt E8X867
>WP_000926658.1|Salmonella enterica Serovar Typhimurium ST4 74|primosomal replication protein N''
MLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGYLEEAGANLVALRQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDAAAPGLGRWQRRRIQHQEFERRLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIENVLARLTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 538,665 | -0.59 | 0.35 | ●○○○○ -0.13 | -0.127162861769586 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 538,665 | 0.77 | 0.89 | ○○○○○ 0.58 | 0.578864306698811 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 538,665 | 1.37 | 0.54 | ○○○○○ 0.89 | 0.887957987661403 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)