Bacterial taxon 909946
Locus STM474_2140
Protein WP_000441103.1
propanediol utilization microcompartment protein PduU
Salmonella enterica Serovar Typhimurium ST4 74
Length 116 aa, Gene pduU, UniProt E8XC09
>WP_000441103.1|Salmonella enterica Serovar Typhimurium ST4 74|propanediol utilization microcompartment protein PduU
MERQPTTDRMIQEYVPGKQVTLAHLIANPGKDLFKKLGLQDAVSAIGILTITPSEASIIACDIATKSGAVEIGFLDRFTGAVVLTGDVSAVEYALKQVTRTLGEMMQFTTCSITRT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,128,663 | -0.4 | 0.48 | ●○○○○ -0.03 | -0.0298381924664179 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,128,663 | 0.39 | 0.77 | ○○○○○ 0.38 | 0.377594539920464 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,128,663 | 1.09 | 0.69 | ○○○○○ 0.74 | 0.74082111445171 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)