Bacterial taxon 909946
Locus STM474_4113
Protein WP_000979262.1
protoheme IX biogenesis protein HemY
Salmonella enterica Serovar Typhimurium ST4 74
Length 399 aa, Gene hemY, UniProt E8XIP1
>WP_000979262.1|Salmonella enterica Serovar Typhimurium ST4 74|protoheme IX biogenesis protein HemY
MMLKVLLLFVLLLAGIVVGPMIAGHQGYVLIQTDNYNIETSVTGLAIILIVAMVVLFAIEWLLRRLFRTGAHTRGWFAGRKRRRARKQTEQALLKLAEGDYQQVEKLMSKNADHAEQPVVNYLLAAEAAQQRGDEARANQHLERAAELAGNDTIPVEITRVRLQLARNENHAARHGVDKLLEVTPRHPEVLRLAEQAYIRTSAWSSLLDIIPSMAKAHVGDEAHRAMLEQQAWIGLMDQARAEQGSEGLRTWWKNQSRKTRHQVALQVAMAEHLIECDDHDMAQQIIIDGLKRQYDDRLVLPIPRLRTNNPEQLEKVLRQQIKTVGDRPLLWSTLGQSLMKHGEWQEATLAFRAALKQRPDAYDYAWLADALDRLHQPEEAAAMRRDGLMLTLQNNPPQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,164,039 | 2.26 | 0.0056 | ○○○○○ 1.35 | 1.34990819161531 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,164,039 | -0.56 | 0.84 | ●○○○○ -0.11 | -0.111506598908929 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,163,827 | -0.44 | 0.89 | ●○○○○ -0.05 | -0.0513697619070172 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,163,939 | 0.19 | 1 | ○○○○○ 0.28 | 0.275369362951705 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,163,827 | 0.2 | 0.8 | ○○○○○ 0.28 | 0.281797132632107 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,163,939 | 0.35 | 0.56 | ○○○○○ 0.36 | 0.35686172741578 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,164,039 | 0.45 | 0.81 | ○○○○○ 0.41 | 0.411307141468493 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,163,827 | 1.3 | 0.42 | ○○○○○ 0.85 | 0.85119671527999 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,163,939 | 1.83 | 0.41 | ○○○○○ 1.13 | 1.12718519090635 | 23637626 |
Retrieved 9 of 9 entries in 0.5 ms
(Link to these results)