Bacterial taxon 909946
Locus STM474_0459
Protein WP_000971352.1
protoheme IX farnesyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 296 aa, Gene cyoE, UniProt E8XKM6
>WP_000971352.1|Salmonella enterica Serovar Typhimurium ST4 74|protoheme IX farnesyltransferase
MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLMLTLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVDFMVPNSQNLLTYVW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 493,599 | -3.44 | 5.8e-10 | ●●○○○ -1.61 | -1.61126696276193 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 493,361 | -2.62 | 2.3e-7 | ●●○○○ -1.19 | -1.18607885949642 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 493,067 | -1.35 | 0.008 | ●○○○○ -0.52 | -0.522705440611357 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 493,599 | -1.49 | 0.26 | ●○○○○ -0.6 | -0.596960599790478 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 493,361 | -1.08 | 0.56 | ●○○○○ -0.39 | -0.385810440425627 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 493,671 | -1 | 0.07 | ●○○○○ -0.34 | -0.344590625250391 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 493,361 | -0.46 | 0.71 | ●○○○○ -0.06 | -0.0636969696838823 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 493,067 | -0.45 | 0.88 | ●○○○○ -0.06 | -0.0563005082302654 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 493,599 | -0.32 | 0.93 | ○○○○○ 0.01 | 0.0119483446336113 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 493,467 | 0.01 | 0.99 | ○○○○○ 0.18 | 0.18340573895763 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 493,467 | 0.46 | 0.76 | ○○○○○ 0.42 | 0.415311225716956 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 493,671 | 0.75 | 0.83 | ○○○○○ 0.57 | 0.568575068017646 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 493,067 | 0.91 | 0.53 | ○○○○○ 0.65 | 0.648777288530535 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 493,467 | 0.92 | 0.78 | ○○○○○ 0.65 | 0.652931700888953 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 493,671 | 1.66 | 0.52 | ○○○○○ 1.04 | 1.03982929636229 | 23637626 |
Retrieved 15 of 15 entries in 1.2 ms
(Link to these results)