Bacterial taxon 909946
Locus STM474_4582
Protein WP_000776531.1
PTS ascorbate transporter subunit IIA
Salmonella enterica Serovar Typhimurium ST4 74
Length 154 aa, Gene ptxA, UniProt E8XAR0
>WP_000776531.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS ascorbate transporter subunit IIA
MKLRDSLAENNSIRLQAEANTWQEAVKIGVDLLVAADVVEPRYYQAILDGVEQFGPYFVIAPGLAMPHGRPEEGVKKTGFSLVTLKKPLEFNHEDNDPVDILITMAAVDANTHQEVGIMQIVNLFEDEANFDRLRACRTAQEVLDLIDRTNAAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,647,694 | 2.11 | 0.0025 | ○○○○○ 1.27 | 1.27027193378909 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,647,694 | 1.11 | 0.67 | ○○○○○ 0.75 | 0.754949538858215 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,647,694 | 1.53 | 0.4 | ○○○○○ 0.97 | 0.971019732641535 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)