Bacterial taxon 909946
Locus STM474_4300
Protein WP_000290522.1
PTS fructose-like transporter subunit IIB
Salmonella enterica Serovar Typhimurium ST4 74
Length 117 aa, Gene frwD, UniProt E8XL72
>WP_000290522.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS fructose-like transporter subunit IIB
MAVPVRHLVAVTACVSGVAHTYMAAERLEKLCQQEKWSIKIETQGALGTENRLTEEDIRRADVVLLITDIELAGVERFTRSRYVQSGISAFLREPQRVMSAVRKLLSAPQHTHLILE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,353,629 | 1.01 | 0.74 | ○○○○○ 0.7 | 0.701339616506935 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,353,629 | 1.57 | 0.5 | ○○○○○ 0.99 | 0.990835955180475 | 23637626 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)