Bacterial taxon 909946
Locus STM474_3482
Protein WP_000609332.1
PTS IIA-like nitrogen regulatory protein PtsN
Salmonella enterica Serovar Typhimurium ST4 74
Length 163 aa, Gene ptsN, UniProt E8XD25
>WP_000609332.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS IIA-like nitrogen regulatory protein PtsN
MINNDTTLQLSSVLNQECTRSGVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAALNDEELYQIITDTEGEQNEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,507,852 | -6.89 | 2.6e-8 | ●●●●○ -3.4 | -3.40118018763437 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,507,852 | -3.54 | 0.0012 | ●●○○○ -1.66 | -1.65876617992068 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,507,852 | -2.98 | 1.3e-17 | ●●○○○ -1.37 | -1.36983820472578 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)