Bacterial taxon 909946
Locus STM474_1854
Protein WP_001518647.1
PTS mannose transporter subunit IID
Salmonella enterica Serovar Typhimurium ST4 74
Length 283 aa, Gene manZ, UniProt E8X8K3
>WP_001518647.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS mannose transporter subunit IID
MVDMTKTTTEKKLTPSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNDARKQAIKRHLEFFNTHPYVAAPVLGVTLAMEEKRANGAEIDDGAINGIKVGLMGPLAGVGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYRKGVDIVKDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSTITGQDGQTRVTTVQTILDQLMPGLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYSVGLLGQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,888,769 | -1.68 | 0.0052 | ●○○○○ -0.69 | -0.694994095260451 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,888,144 | 2.27 | 1.8e-5 | ○○○○○ 1.36 | 1.35715741384294 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,888,769 | -1.47 | 0.52 | ●○○○○ -0.59 | -0.586864524374832 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,888,769 | -0.54 | 0.99 | ●○○○○ -0.11 | -0.105007084860996 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,888,144 | -0.17 | 0.92 | ○○○○○ 0.09 | 0.0868450174438475 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,888,144 | 0.37 | 0.98 | ○○○○○ 0.37 | 0.369689672988808 | 23637626 |
Retrieved 6 of 6 entries in 0.7 ms
(Link to these results)