Bacterial taxon 909946
Locus STM474_4742
Protein WP_001575392.1
PTS mannose/fructose/sorbose transporter family subunit IID
Salmonella enterica Serovar Typhimurium ST4 74
Length 278 aa, Gene ptnD, UniProt E8XCI4
>WP_001575392.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS mannose/fructose/sorbose transporter family subunit IID
MISDKDRQQAETTGLVTARDLRRVFWRSFQMEFSWNYERQMNLAFVYTLIPVLKKLYSRKEDLAEALKRHLAFFNTTPHIVTLILGITVAMEEKNSQQKEMDASSIDNVKASLMGPLAGIGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLVFNVPHILARWFFTRWGYVLGTGVLQRIQQSGMMESLTYGASIIGLMVVGAMTASMIDITIPITFGTGEAKTHVQDIINDIMPCLLPLISFAIVYWLLGKKVKPLTIIGGIALVGIFGSWIGLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,817,612 | -4.11 | 0.00036 | ●●○○○ -1.96 | -1.95637051599887 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,817,612 | -2.93 | 7.0e-9 | ●●○○○ -1.35 | -1.34632905106677 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,817,630 | -2.29 | 0.027 | ●●○○○ -1.01 | -1.01267970016765 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,817,630 | -1.88 | 0.00018 | ●○○○○ -0.8 | -0.798589689253613 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,817,630 | -1.88 | 0.12 | ●○○○○ -0.8 | -0.801394716314571 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,817,612 | -1.45 | 0.67 | ●○○○○ -0.58 | -0.575011660742678 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)