Bacterial taxon 909946
Locus STM474_1319
Protein WP_000459883.1
PTS N,N'-diacetylchitobiose transporter subunit IIA
Salmonella enterica Serovar Typhimurium ST4 74
Length 115 aa, Gene celC, UniProt E8XGC1
>WP_000459883.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS N,N'-diacetylchitobiose transporter subunit IIA
MFDLENVVDNQTAAEELEEVVMGLIINSGQARSLAYGALRKAKEGDFEAAKAMMDQSRIALNEAHLVQTKLIEGDQGEGKMKVSLVLVHAQDHLMTSMLARELIAELIELHEKLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,350,578 | -3.93 | 0.0022 | ●●○○○ -1.86 | -1.86371810723175 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,350,578 | -1.44 | 0.005 | ●○○○○ -0.57 | -0.571540428712813 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,350,578 | -0.95 | 0.65 | ●○○○○ -0.32 | -0.317021816513106 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)