Bacterial taxon 909946
Locus STM474_2971
Protein WP_000199033.1
PTS sorbitol transporter subunit IIB
Salmonella enterica Serovar Typhimurium ST4 74
Length 323 aa, Gene srlE, UniProt E8XK72
>WP_000199033.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS sorbitol transporter subunit IIB
MTRVRIEKGAGGWGGPLELDVTPDKKIVYITAGTRPAIVDKLAQLTGWQAVDGFKEGEPPEAEIGAAIIDCGGTLRCGIYPKRRIPTINIHSTGKSGPLAQYIVEDIYVSGVKEENITLVGETPASPQPAKTTLGRDYDTSKKITEQSDGLLAKVGMGMGSAVAVLFQSGRDTIDTVLKTILPFMAFVSALIGIIMASGLGDWIAHGLAPLASHPLGLVTLALICSFPLLSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLAEAKQDTVRVGVPSVLVGRFLTGAPTVLIAWFVSGFIYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,002,210 | 2.32 | 0.0025 | ○○○○○ 1.38 | 1.38236751796087 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,002,210 | 0.24 | 0.86 | ○○○○○ 0.3 | 0.302997225562649 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,002,210 | 0.6 | 0.88 | ○○○○○ 0.49 | 0.487285799751786 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,002,374 | 0.89 | 0.77 | ○○○○○ 0.64 | 0.639813714408254 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,002,374 | 1.31 | 0.075 | ○○○○○ 0.86 | 0.857712662522998 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,002,374 | 1.69 | 0.31 | ○○○○○ 1.06 | 1.05572008227091 | 23637626 |
Retrieved 6 of 6 entries in 0.5 ms
(Link to these results)