Bacterial taxon 909946
Locus STM474_2441
Protein WP_000901812.1
PTS sugar transporter subunit IIA
Salmonella enterica Serovar Typhimurium ST4 74
Length 147 aa, Gene n/a, UniProt E8XEZ7
>WP_000901812.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS sugar transporter subunit IIA
MLGTWLSDATITLQESVETWPQALEICGKPLLDAGVIAPEYLTAIVQQHQKLGPYYVLAPGLAMPHARPEEGAKGLGLSLLKLQHGVSFGADEFDPVDIIIMLAAPDKHSHIEMISALAELFSSDVDMEKLHQAKNLEDIKTIIDRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,454,520 | -4.3 | 1.4e-15 | ●●●○○ -2.06 | -2.05757406069366 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,454,587 | -2.08 | 0.00031 | ●○○○○ -0.9 | -0.900940297345906 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,454,807 | 1.97 | 0.01 | ○○○○○ 1.2 | 1.20114863542645 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,454,587 | -1.98 | 0.089 | ●○○○○ -0.85 | -0.85181610754937 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,454,807 | -1.08 | 0.46 | ●○○○○ -0.38 | -0.384084165584264 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,454,520 | -0.27 | 0.95 | ○○○○○ 0.04 | 0.0363124559871064 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,454,587 | 0.06 | 1 | ○○○○○ 0.21 | 0.207997906332843 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,454,807 | 0.14 | 1 | ○○○○○ 0.25 | 0.251521945339219 | 23637626 |
Retrieved 8 of 8 entries in 0.8 ms
(Link to these results)