Bacterial taxon 909946
Locus STM474_4739
Protein WP_000820693.1
PTS sugar transporter subunit IIA
Salmonella enterica Serovar Typhimurium ST4 74
Length 140 aa, Gene n/a, UniProt E8XCI1
>WP_000820693.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS sugar transporter subunit IIA
MKRHYIFASHGTLASGVLNSVELILGKRSNVWTLCAYVEESVDLSQQVDTLIARIPPEDEIIALTDIFAGSVNNEFVRYLSRENFHLLAGINLPLVIDLFMSENDGNTTHTIMTALADSKENIQYCNQTITSAMQSDKDF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,815,633 | -2.63 | 0.019 | ●●○○○ -1.19 | -1.19077075480281 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,815,521 | -2.41 | 0.024 | ●●○○○ -1.08 | -1.0751921018607 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,815,521 | -1.07 | 0.042 | ●○○○○ -0.38 | -0.38036058658654 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,815,633 | -0.55 | 0.69 | ●○○○○ -0.11 | -0.107159168173799 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,815,521 | -0.54 | 0.88 | ●○○○○ -0.1 | -0.101296046794503 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,815,633 | 0.57 | 0.47 | ○○○○○ 0.47 | 0.474011820995454 | 23637626 |
Retrieved 6 of 6 entries in 0.7 ms
(Link to these results)