Bacterial taxon 909946
Locus STM474_4775
Protein WP_000224870.1
purine-nucleoside phosphorylase
Salmonella enterica Serovar Typhimurium ST4 74
Length 239 aa, Gene deoD, UniProt E8XDA3
>WP_000224870.1|Salmonella enterica Serovar Typhimurium ST4 74|purine-nucleoside phosphorylase
MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDGEMFDVMEKYGVLGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLGDKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,846,410 | -1.31 | 0.07 | ●○○○○ -0.5 | -0.502094556452403 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,846,410 | -0.49 | 0.78 | ●○○○○ -0.08 | -0.0787466983951822 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,846,410 | -0.04 | 0.99 | ○○○○○ 0.15 | 0.154293470260028 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)