Bacterial taxon 909946
Locus STM474_4763
Protein WP_000978805.1
pyrimidine 5'-nucleotidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 226 aa, Gene n/a, UniProt E8XCK2
>WP_000978805.1|Salmonella enterica Serovar Typhimurium ST4 74|pyrimidine 5'-nucleotidase
MMKWDWIFFDADETLFTFDSFTGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITSLQLQHARFQSWAERLNVAPGLLNDAFISAMAEICSPLPGAVSLLNAIRGQAKIGIITNGFTALQQTRLERTGLREYFDLLVISEQVGVAKPDPKIFNYALEQAGNPDRSRVLMVGDTAESDILGGINAGLSTCWLNAHHREQPAGIHPTWTVASLSELEQLLCKH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,834,273 | 2 | 0.0057 | ○○○○○ 1.21 | 1.21386279966311 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,834,366 | -0.23 | 0.95 | ○○○○○ 0.06 | 0.0600352671478374 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,834,366 | 1.38 | 0.29 | ○○○○○ 0.9 | 0.895252935550342 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,834,273 | 1.39 | 0.53 | ○○○○○ 0.9 | 0.901071541271632 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,834,273 | 2.29 | 0.32 | ○○○○○ 1.37 | 1.36685541167401 | 23637626 |
Retrieved 5 of 5 entries in 1.6 ms
(Link to these results)