Bacterial taxon 909946
Locus STM474_3978
Protein WP_000147832.1
radical SAM protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 176 aa, Gene yidF, UniProt E8XHN8
>WP_000147832.1|Salmonella enterica Serovar Typhimurium ST4 74|radical SAM protein
MTGRQDIVVSDDQIQVVVNRQNSQRPQQLYRNLQRLGIRNVHFIPLLEHDRNGMLTEDSLCSADWGRFLNSVFDIWVREDIQRISVRLFDETLQQWCGGRNGAEAPDKVPLSAECQKCSLLRFCGGGCPEHRDSQGKNQLCEGYQTFFNYSSPHMRVMRDLLKQHRSPEELMAMLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,027,518 | 1.62 | 0.031 | ○○○○○ 1.02 | 1.01898542892353 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,027,518 | 0.57 | 0.89 | ○○○○○ 0.47 | 0.474013646386703 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,027,518 | 1.49 | 0.43 | ○○○○○ 0.95 | 0.951805731343182 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)