Bacterial taxon 909946
Locus STM474_4461
Protein WP_000412686.1
redox-sensitive transcriptional activator SoxR
Salmonella enterica Serovar Typhimurium ST4 74
Length 152 aa, Gene soxR, UniProt E8X9R6
>WP_000412686.1|Salmonella enterica Serovar Typhimurium ST4 74|redox-sensitive transcriptional activator SoxR
MEKKSPRLKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAIIKIAQRIGIPLATIGDAFGILPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDRLGEHGTGARLLEDD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,526,029 | -1.77 | 0.0021 | ●○○○○ -0.74 | -0.744063039318187 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,526,029 | -0.49 | 0.75 | ●○○○○ -0.08 | -0.0778388162987028 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,526,029 | -0.15 | 0.97 | ○○○○○ 0.1 | 0.0984206802248422 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)